BANF1 (NM_001143985) Human Tagged ORF Clone
CAT#: RC227624
BANF1 (Myc-DDK-tagged)-Human barrier to autointegration factor 1 (BANF1), transcript variant 2
"NM_001143985" in other vectors (6)
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | BANF1 |
Synonyms | BAF; BCRP1; D14S1460; NGPS |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC227624 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAACCTCCCAAAAGCACCGAGACTTCGTGGCAGAGCCCATGGGGGAGAAGCCAGTGGGGAGCCTGG CTGGGATTGGTGAAGTCCTGGGCAAGAAGCTTGAGGAAAGGGGTTTTGACAAGGCCTATGTTGTCCTTGG CCAGTTTCTGGTGCTAAAGAAAGATGAAGACCTCTTCCGGGAATGGCTGAAAGACACTTGTGGCGCCAAC GCCAAGCAGTCCCGGGACTGCTTCGGATGCCTTCGAGAGTGGTGCGACGCCTTCTTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC227624 protein sequence
Red=Cloning site Green=Tags(s) MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN AKQSRDCFGCLREWCDAFL myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001143985 |
ORF Size | 267 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001143985.1, NP_001137457.1 |
RefSeq Size | 1122 bp |
RefSeq ORF | 270 bp |
Locus ID | 8815 |
MW | 10.1 kDa |
Gene Summary | The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jan 2009] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC324703 | BANF1 (untagged)-Human barrier to autointegration factor 1 (BANF1), transcript variant 2 |
USD 420.00 |
|
RG227624 | BANF1 (GFP-tagged) - Human barrier to autointegration factor 1 (BANF1), transcript variant 2 |
USD 460.00 |
|
RC227624L1 | Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 2, Myc-DDK-tagged |
USD 620.00 |
|
RC227624L2 | Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 2, mGFP tagged |
USD 620.00 |
|
RC227624L3 | Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 2, Myc-DDK-tagged |
USD 620.00 |
|
RC227624L4 | Lenti ORF clone of Human barrier to autointegration factor 1 (BANF1), transcript variant 2, mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review