ZNF268 (NM_001165884) Human Tagged ORF Clone

CAT#: RC228116

  • TrueORF®

ZNF268 (Myc-DDK-tagged)-Human zinc finger protein 268 (ZNF268), transcript variant 6


  "NM_001165884" in other vectors (4)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "ZNF268"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZNF268
Synonyms HZF3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC228116 representing NM_001165884
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACCAGGGTCCGGACAGCTTCTATTTGGACACAGTCTGGAAAATTGATGATCTTATGGATTGGCA
TCAGGAAAATAAAGACAAGCTGGGAAGTACGGCAAAAAGCTTTGAATGCACTACATTTGGAAAACTATGT
CTTCTTAGTACAAAGTATCTTTCAAGACAAAAACCTCATAAATGTGGCACGCATGGAAAGAGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC228116 representing NM_001165884
Red=Cloning site Green=Tags(s)

MATRVRTASIWTQSGKLMILWIGIRKIKTSWEVRQKALNALHLENYVFLVQSIFQDKNLINVARMERV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001165884
ORF Size 204 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001165884.2, NP_001159356.2
RefSeq Size 5332
RefSeq ORF 207
Locus ID 10795
Protein Families Transcription Factors
MW 8 kDa
Gene Summary Isoform 2: Contributes to cervical carcinogenesis in part through the TNF-alpha-induced NF-kappa-B signaling pathway by interacting with the I-kappa-B-kinase (IKK) core complex. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.