CRIP2 (NM_001270841) Human Tagged ORF Clone

CAT#: RC231594

  • TrueORF®

CRIP2 (Myc-DDK tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 3


  "NM_001270841" in other vectors (2)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "CRIP2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CRIP2
Synonyms CRIP; CRP2; ESP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231594 representing NM_001270841
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCCAAATGCCCCAAGTGCGACAAGACCGTGTACTTCGCTGAGAAGGTGACGTCTCTGGGCAAGG
ATTGGCACCGGCCCTGCCTGCGCTGCGAGCGCTGCGGGAAGACACTGACCCCCGGCGGGCACGCGGAGCA
CGACGGCCAGCCCTACTGCCACAAGCCCTGCTATGGAATCCTCTTCGGACCCAAGGGAGTGAACACCGGT
GCGGTGGGCAGCTACATCTATGACCGGGACCCCGAAGGCAAGGTCCAGCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231594 representing NM_001270841
Red=Cloning site Green=Tags(s)

MASKCPKCDKTVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTG
AVGSYIYDRDPEGKVQP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001270841
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001270841.1, NP_001257770.1
RefSeq Size 884
RefSeq ORF 264
Locus ID 1397
MW 10 kDa
Gene Summary This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.