DEFB119 (NM_001271209) Human Tagged ORF Clone

CAT#: RC231596

  • TrueORF®

DEFB119 (Myc-DDK tagged) - Homo sapiens defensin, beta 119 (DEFB119), transcript variant 4


  "NM_001271209" in other vectors (2)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "DEFB119"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DEFB119
Synonyms DEFB-19; DEFB-20; DEFB20; DEFB120; ESC42-RELA; ESC42-RELB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231596 representing NM_001271209
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACTTCTTTACCTGTTTCTTGCCATCCTTCTGGCCATAGAAGAACCAGTGATATCAGAGTGTTGGA
TGGATGGACACTGCCGGTTGTTGTGCAAAGATGGTGAAGACAGCATCATACGCTGCCGAAATCGTAAACG
GTGCTGTGTTCCTAGTCGTTATTTAACAATCCAACCAGTAACAATTCATGGAATCCTTGGCTGGACCACT
CCTCAGATGTCCACAACAGCTCCAAAAATGAAGACAAATATAACTAATAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231596 representing NM_001271209
Red=Cloning site Green=Tags(s)

MKLLYLFLAILLAIEEPVISECWMDGHCRLLCKDGEDSIIRCRNRKRCCVPSRYLTIQPVTIHGILGWTT
PQMSTTAPKMKTNITNR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001271209
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001271209.1, NP_001258138.1
RefSeq Size 510
RefSeq ORF 264
Locus ID 245932
Protein Families Secreted Protein
MW 10.5 kDa
Gene Summary This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.