IFT43 (NM_001255995) Human Tagged ORF Clone

CAT#: RC231678

  • TrueORF®

IFT43 (Myc-DDK tagged) - Homo sapiens intraflagellar transport 43 homolog (Chlamydomonas) (IFT43), transcript variant 3


  "NM_001255995" in other vectors (2)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "IFT43"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IFT43
Synonyms C14orf179; CED3; RP81; SRTD18
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231678 representing NM_001255995
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGATTTGCTCGACTTGGACGAGGAGCTTCGCTACAGCTTGGCTACCTCCAGGGCCAAGATGGGTC
GCCGAGCTCAACAGGAGTCAGCGCAGGCCGAGAATCACCTCAATGGCAAGAATTCCTCTTTGACTCTGAC
TGGAGAGACTTCCTCTGCTAAATTACCTCGCTGCCGACAGGGAGGCTGGGCAGGTGATTCCGTGAAGGCT
TCGAAGTTTAGGAGGAAGGCTTCTGAAGAAATAGAAGAGTACGTTTCCAGTATTCTTATTCTTATGGTAT
CCTATGTTGATCTTGGTCAACAGTGCAGTCTTGGTGGTCATGATCTGTTCCACCTATGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231678 representing NM_001255995
Red=Cloning site Green=Tags(s)

MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA
SKFRRKASEEIEEYVSSILILMVSYVDLGQQCSLGGHDLFHLC

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001255995
ORF Size 339 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001255995.1, NP_001242924.1
RefSeq Size 911
RefSeq ORF 342
Locus ID 112752
MW 13 kDa
Gene Summary This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.