ZIC4 (NM_001243256) Human Tagged ORF Clone

CAT#: RC231739

  • TrueORF®

ZIC4 (Myc-DDK tagged) - Homo sapiens Zic family member 4 (ZIC4), transcript variant 6


  "NM_001243256" in other vectors (2)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "ZIC4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZIC4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC231739 representing NM_001243256
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGATACAAGACATCCTTGGTGATGAGGAAACGATTACGGCTTTACCGAAACACTCTTAAAGAGTCAA
GCGAGAAGCCCTTCAGATGCGAGTTCGAGGGCTGCGAGCGGCGCTTCGCCAACAGCAGCGACCGTAAGAA
GCATTCGCACGTGCACACTAGCGACAAGCCATACACGTGCAAGGTGCGGGGCTGCGACAAGTGCTACACG
CACCCCAGCTCGCTGCGTAAGCACATGAAGGTGCACGGGCGCTCGCCGCCGCCCAGCTCTGGCTACGATT
CGGCTACACCGTCTGCCCTCGTGTCGCCCTCGTCGGACTGCGGCCACAAGTCCCAGGTGGCCTCCTCGGC
GGCGGTGGCGGCGCGTACCGCCGACTTGAGCGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC231739 representing NM_001243256
Red=Cloning site Green=Tags(s)

MRYKTSLVMRKRLRLYRNTLKESSEKPFRCEFEGCERRFANSSDRKKHSHVHTSDKPYTCKVRGCDKCYT
HPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQVASSAAVAARTADLSE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001243256
ORF Size 384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001243256.1, NP_001230185.1
RefSeq Size 3660
RefSeq ORF 387
Locus ID 84107
MW 14.8 kDa
Gene Summary This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. Heterozygous deletion of these linked genes is involved in Dandy-Walker malformation, which is a congenital cerebellar malformation. Multiple transcript variants have been identified for this gene. [provided by RefSeq, Dec 2009]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.