GNAL (NM_001261444) Human Tagged ORF Clone

CAT#: RC231965

GNAL (Myc-DDK tagged) - Homo sapiens guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type (GNAL), transcript variant 5

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: GNAL
• Synonyms: DYT25
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC231965 representing NM_001261444
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTTGATGTTGGTGGCCAGAGGGATGAGAGGAGAAAATGGATCCAGTGCTTTAACGATGTCACAGCTA
  TCATTTACGTCGCAGCCTGCAGTAGCTACAACATGGTGATTCGAGAAGATAACAACACCAACAGGCTGAG
  AGAGTCCCTGGATCTTTTTGAAAGCATCTGGAACAACAGGTGGTTACGGACCATTTCTATCATCTTGTTC
  TTGAACAAACAAGATATGCTGGCAGAAAAAGTCTTGGCAGGGAAATCAAAAATTGAAGACTATTTCCCAG
  AATATGCAAATTATACTGTTCCTGAAGACGCAACACCAGATGCAGGAGAAGATCCCAAAGTTACAAGAGC
  CAAGTTCTTTATCCGGGACCTGTTTTTGAGGATCAGCACGGCCACCGGTGACGGCAAACATTACTGCTAC
  CCGCACTTCACCTGCGCCGTGGACACAGAGAACATCCGCAGGGTGTTCAACGACTGCCGCGACATCATCC
  AGCGGATGCACCTCAAGCAGTATGAGCTCTTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC231965 representing NM_001261444
  Red=Cloning site Green=Tags(s)
  
  MFDVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILF
  LNKQDMLAEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCY
  PHFTCAVDTENIRRVFNDCRDIIQRMHLKQYELL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001261444
• ORF Size: 522 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001261444.1, NP_001248373.1
• RefSeq Size: 5568 bp
• RefSeq ORF: 525 bp
• Locus ID: 2774
• Cytogenetics: 18p11.21
• Protein Families: Druggable Genome
• Protein Pathways: Calcium signaling pathway, Olfactory transduction
• MW: 21 kDa
• Gene Summary: 'This gene encodes a stimulatory G protein alpha subunit which mediates odorant signaling in the olfactory epithelium. This protein couples dopamine type 1 receptors and adenosine A2A receptors and is widely expressed in the central nervous system. Mutations in this gene have been associated with dystonia 25 and this gene is located in a susceptibility region for bipolar disorder and schizophrenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]'