Apg12 (ATG12) (NM_001277783) Human Tagged ORF Clone

CAT#: RC235466

ATG12 (myc-DDK-tagged) - Human autophagy related 12 (ATG12), transcript variant 5

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ATG12
• Synonyms: APG12; APG12L; FBR93; HAPG12
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC235466 representing NM_001277783
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGAGGAGCCGCAGTCTGTGTTGCAGCTTCCTACTTCAATTGCTGCTGGAGGGGAAGGACTTACGG
  ATGTCTCCCCAGAAACAACCACCCCGGAGCCCCCGTCTTCCGCTGCAGTTTCCCCGGGAACAGAGGAACC
  TGCTGGCGACACCAAGAAAAAAATTTATTTATGTGAATCAGTCCTTTGCTCCTTCCCCAGACCAAGAAGT
  TGGAACTCTCTA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC235466 representing NM_001277783
  Red=Cloning site Green=Tags(s)
  
  MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRS
  WNSL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001277783
• ORF Size: 222 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001277783.1, NP_001264712.1
• RefSeq Size: 4193
• RefSeq ORF: 225
• Locus ID: 9140
• Protein Pathways: Regulation of autophagy, RIG-I-like receptor signaling pathway
• MW: 8.2 kDa
• Gene Summary: Autophagy is a process of bulk protein degradation in which cytoplasmic components, including organelles, are enclosed in double-membrane structures called autophagosomes and delivered to lysosomes or vacuoles for degradation. ATG12 is the human homolog of a yeast protein involved in autophagy (Mizushima et al., 1998 [PubMed 9852036]). [supplied by OMIM, Mar 2008]