Apc11 (ANAPC11) (NM_001289419) Human Tagged ORF Clone

CAT#: RC235546

ANAPC11 (myc-DDK-tagged) - Human anaphase promoting complex subunit 11 (ANAPC11), transcript variant 13

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: ANAPC11
• Synonyms: APC11; Apc11p; HSPC214
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC235546 representing NM_001289419
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGAACTGTGGCATCTGCAGGATGGCATTTAACGGATGCTGCCCTGACTGTGAGTGTCCCCTCCATGC
  TGTCTGAGCGGCCCCGACTGCAAGGTGCCCGGCGACGACTGCCCGCTGGTGTGGGGCCAGTGCTCCCACT
  GCTTCCACATGCATTGCATCCTCAAGTGGCTGCACGCACAGCAGGTGCAGCAGCACTGCCCCATGTGCCG
  CCAGGAATGGAAGTTCAAGGAGTGAGGCCCGACCTGGCTCTCGCTGGAGGGGCATCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC235546 representing NM_001289419
  Red=Cloning site Green=Tags(s)
  
  MRTVASAGWHLTDAALTVSVPSMLSERPRLQGARRRLPAGVGPVLPLLPHALHPQVAARTAGAAALPHVP
  PGMEVQGVRPDLALAGGAS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001289419
• ORF Size: 267 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001289419.1, NP_001276348.1
• RefSeq Size: 964
• RefSeq ORF: 270
• Locus ID: 51529
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis
• MW: 9.5 kDa
• Gene Summary: Together with the cullin protein ANAPC2, constitutes the catalytic component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. May recruit the E2 ubiquitin-conjugating enzymes to the complex. [UniProtKB/Swiss-Prot Function]