HERC4 (NM_001278187) Human Tagged ORF Clone

CAT#: RC235685

HERC4 (myc-DDK-tagged) - Human HECT and RLD domain containing E3 ubiquitin protein ligase 4 (HERC4), transcript variant 5

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: HERC4
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC235685 representing NM_001278187
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTGTGCTGGGGAAATGCATCCTTTGGGCAGCTAGGTTTGGGTGGAATTGATGAAGAAATTGTACTAG
  AGCCCAGAAAAAGTGACTTCTTTATAAATAAAAGGGTCCGAGATGTAGGATGTGGACTCAGACATACTGT
  GTTTGTTCTGGATGATGGAACAGTGTACACATGTGGATGTAATGATCTAGGACAGCTAGGTCATGAAAAA
  TCCAGAAAGAAACCAGAGTTTCGCTCTTGTTTCCCAGGCCGGAGTGCAATGGCGCCATCTCGGCTCACCG
  CAACCTCTGCCTCCCAGGTTCAAGCAATTCTCCTGCCTCAGCCTCCCGAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC235685 representing NM_001278187
  Red=Cloning site Green=Tags(s)
  
  MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEK
  SRKKPEFRSCFPGRSAMAPSRLTATSASQVQAILLPQPPE
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001278187
• ORF Size: 330 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001278187.1, NP_001265116.1
• RefSeq Size: 2147
• RefSeq ORF: 333
• Locus ID: 26091
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis
• MW: 12.5 kDa
• Gene Summary: HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]). [supplied by OMIM, Mar 2008]