LSM4 (NM_001252129) Human Tagged ORF Clone

CAT#: RC235824

  • TrueORF®

LSM4 (myc-DDK-tagged) - Human LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM4), transcript variant 2


  "NM_001252129" in other vectors (1)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "LSM4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol LSM4
Synonyms GRP; YER112W
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC235824 representing NM_001252129
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGTGGAGCTGAAAAATGGGGAGACGTACAATGGACACCTGGTGAGCTGCGACAACTGGATGAACA
TTAACCTGCGAGAAGTCATCTGCACGTCCAGGGACGGGGACAAGTTCTGGCGGATGCCCGAGTGCTACAT
CCGCGGCAGCACCATCAAGTACCTGCGCATCCCCGACGAGATCATCGACATGGTCAAGGAGGAGGTGGTG
GCCAAGGGCCGCGGCCGCGGAGGCCTGCAGCAGCAGAAGCAGCAGAAAGGCCGCGGCATGGGCGGCGCTG
GCCGAGGTGTGTTTGGTGGCCGGGGCCGAGGTGGGATCCCGGGCACAGGCAGAGGCCAGCCAGAGAAGAA
GCCTGGCAGACAGGCGGGCAAACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC235824 representing NM_001252129
Red=Cloning site Green=Tags(s)

MLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVV
AKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001252129
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001252129.1, NP_001239058.1
RefSeq Size 1783
RefSeq ORF 378
Locus ID 25804
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation, Spliceosome
MW 14.3 kDa
Gene Summary This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.