Ikaros (IKZF1) (NM_001291845) Human Tagged ORF Clone

CAT#: RC236285

IKZF1 (myc-DDK-tagged) - Human IKAROS family zinc finger 1 (Ikaros) (IKZF1), transcript variant 15

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: IKZF1
• Synonyms: CVID13; Hs.54452; IK1; IKAROS; LyF-1; LYF1; PPP1R92; PRO0758; ZNFN1A1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236285 representing NM_001291845
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGGAAGGAAAGCCCCCCTGTAAGCGATACTC
  CAGATGAGGGCGATGAGCCCATGCCGATCCCCGAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTC
  CAAGAGTGACAGAGTCGTGGTTACATATGGGGCTGATGACTTTAGGGATTTCCATGCAATAATTCCCAAA
  TCTTTCTCTCGTAAGTATATGCCTTGCTTCTGGAAAACAAAAGCATGCCTTCATCTCCTATCATGTAAAT
  ATCGTACGTGCATGTTCCTTCATCAACCCCCGAGATACATTAAATATTCACTGTTCTATTCGTTAGACAC
  CTACCATATCATTTTTGGGTATTTATACCATAAAGTGCAAAACGAAGGTCTAGGCAGTTGTGCGGTGTCC
  TGGGAGCATGGCAGTGGAGTAACAGTAAGGGTTGGAGTCACAGTAGCACTGATGGGATTGTTACTTCGCA
  GATGCTGCTGGACAGCTTTGAGATTACTCCTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236285 representing NM_001291845
  Red=Cloning site Green=Tags(s)
  
  MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVVTYGADDFRDFHAIIPK
  SFSRKYMPCFWKTKACLHLLSCKYRTCMFLHQPPRYIKYSLFYSLDTYHIIFGYLYHKVQNEGLGSCAVS
  WEHGSGVTVRVGVTVALMGLLLRRCCWTALRLLL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001291845
• ORF Size: 522 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001291845.1, NP_001278774.1
• RefSeq Size: 1896
• RefSeq ORF: 525
• Locus ID: 10320
• Protein Families: Druggable Genome, Transcription Factors
• MW: 20.1 kDa
• Gene Summary: This gene encodes a transcription factor that belongs to the family of zinc-finger DNA-binding proteins associated with chromatin remodeling. The expression of this protein is restricted to the fetal and adult hemo-lymphopoietic system, and it functions as a regulator of lymphocyte differentiation. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. Most isoforms share a common C-terminal domain, which contains two zinc finger motifs that are required for hetero- or homo-dimerization, and for interactions with other proteins. The isoforms, however, differ in the number of N-terminal zinc finger motifs that bind DNA and in nuclear localization signal presence, resulting in members with and without DNA-binding properties. Only a few isoforms contain the requisite three or more N-terminal zinc motifs that confer high affinity binding to a specific core DNA sequence element in the promoters of target genes. The non-DNA-binding isoforms are largely found in the cytoplasm, and are thought to function as dominant-negative factors. Overexpression of some dominant-negative isoforms have been associated with B-cell malignancies, such as acute lymphoblastic leukemia (ALL). [provided by RefSeq, May 2014]