Casein Kinase 2 beta (CSNK2B) (NM_001282385) Human Tagged ORF Clone

CAT#: RC236605

CSNK2B (myc-DDK-tagged) - Human casein kinase 2, beta polypeptide (CSNK2B), transcript variant 2

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CSNK2B
• Synonyms: CK2B; CK2N; Ckb1; Ckb2; CSK2B; G5A
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC236605 representing NM_001282385
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGCAGCTCAGAGGAGGTGTCCTGGATTTCCTGGTTCTGTGGGCTCCGTGGCAATGAATTCTTCTGTG
  AAGTGGATGAAGACTACATCCAGGACAAATTTAATCTTACTGGACTCAATGAGCAGGTCCCTCACTATCG
  ACAAGCTCTAGACATGATCTTGGACCTGGAGCCTGATGAAGAACTGGAAGACAACCCCAACCAGAGTGAC
  CTGATTGAGCAGGCAGCCGAGATGCTTTATGGATTGATCCACGCCCGCTACATCCTTACCAACCGTGGCA
  TCGCCCAGATGTTGGAAAAGTACCAGCAAGGAGACTTTGGTTACTGTCCTCGTGTGTACTGTGAGAACCA
  GCCAATGCTTCCCATTGACATCCCAGGTGAAGCCATGGTGAAGCTCTACTGCCCCAAGTGCATGGATGTG
  TACACACCCAAGTCATCAAGACACCATCACACGGATGGCGCCTACTTCGGCACTGGTTTCCCTCACATGC
  TCTTCATGGTGCATCCCGAGTACCGGCCCAAGAGACCTGCCAACCAGTTTGTGCCCAGGCTCTACGGTTT
  CAAGATCCATCCGATGGCCTACCAGCTGCAGCTCCAAGCCGCCAGCAACTTCAAGAGCCCAGTCAAGACG
  ATTCGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC236605 representing NM_001282385
  Red=Cloning site Green=Tags(s)
  
  MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSD
  LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIDIPGEAMVKLYCPKCMDV
  YTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKT
  IR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001282385
• ORF Size: 636 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001282385.1, NP_001269314.1
• RefSeq Size: 1140 bp
• RefSeq ORF: 639 bp
• Locus ID: 1460
• Cytogenetics: 6p21.33
• Protein Families: Druggable Genome
• Protein Pathways: Adherens junction, Tight junction, Wnt signaling pathway
• MW: 25.1 kDa
• Gene Summary: 'This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2013]'