DDB2 (NM_001300734) Human Tagged ORF Clone

CAT#: RC236822

  • TrueORF®

DDB2 (myc-DDK-tagged) - Human damage-specific DNA binding protein 2, 48kDa (DDB2), transcript variant D1


  "NM_001300734" in other vectors (1)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "DDB2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DDB2
Synonyms DDBB; UV-DDB2; XPE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC236822 representing NM_001300734
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCCAAGAAACGCCCAGAAACCCAGAAGACCTCCGAGATTGTATTACGCCCCAGGAACAAGAGGA
GCAGGAGTCCCCTGGAGCTGGAGCCCGAGGCCAAGAAGCTCTGTGCGAAGGGCTCCGGTCCTAGCAGAAG
ATGTGACTCAGACTGCCTCTGGGTGGGGCTGGCTGGCCCACAGATCCTGCCACCATGCCGCAGCATCGTC
AGGACCCTCCACCAGCATAAGCTGGGCAGAGCTTCCTGGCCATCTGTCCAGCAGGGGCTCCAGCAGTCCT
TTTTGCACACTCTGGATTCTTACCGGATATTACAAAAGGCTGCCCCCTTTGACAGGAGGGCTACATCCTT
GGCGTGGCACCCAACTCACCCCAGCACCGTGGCTGTGGGTTCCAAAGGGGGAGATATCATGCTCTGGAAT
TTTGGCATCAAGGACAAACCCACCTTCATCAAAGGGGCAGCCTGGCATCCTCGCTACAACCTCATTGTTG
TGGGCCGATACCCAGATCCTAATTTCAAAAGTTGTACCCCTTATGAATTGAGGACGATCGACGTGTTCGA
TGGAAACTCAGGGAAGATGATGTGTCAGCTCTATGACCCAGAATCTTCTGGCATCAGTTCGCTTAATGAA
TTCAATCCCATGGGGGACACGCTGGCCTCTGCAATGGGTTACCACATTCTCATCTGGAGCCAGGAGGAAG
CCAGGACACGGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC236822 representing NM_001300734
Red=Cloning site Green=Tags(s)

MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGPQILPPCRSIV
RTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWN
FGIKDKPTFIKGAAWHPRYNLIVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNE
FNPMGDTLASAMGYHILIWSQEEARTRK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001300734
ORF Size 714 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001300734.1, NP_001287663.1
RefSeq Size 1303 bp
RefSeq ORF 717 bp
Locus ID 1643
Cytogenetics 11p11.2
Protein Families Druggable Genome
Protein Pathways Nucleotide excision repair, p53 signaling pathway, Ubiquitin mediated proteolysis
MW 27.2 kDa
Gene Summary 'This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.