RFC2 (NM_001278792) Human Tagged ORF Clone

CAT#: RC236936

  • TrueORF®

RFC2 (myc-DDK-tagged) - Human replication factor C (activator 1) 2, 40kDa (RFC2), transcript variant 4


  "NM_001278792" in other vectors (1)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "RFC2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol RFC2
Synonyms RFC40
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC236936 representing NM_001278792
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGCCCAACATCATCATTGCGGGGCATTGACGTTGTGAGGAATAAAATTAAAATGTTTGCTCAACAAA
AAGTCACTCTTCCCAAAGGCCGACATAAGATCATCATTCTGGATGAAGCAGACAGCATGACCGACGGAGC
CCAGCAAGCCTTGAGGAGAACCATGGAAATCTACTCTAAAACCACTCGCTTCGCCCTTGCTTGTAATGCT
TCGGATAAGATCATCGAGCCCATTCAGTCCCGCTGTGCAGTCCTCCGGTACACAAAGCTGACCGACGCCC
AGATCCTCACCAGGCTGATGAATGTTATCGAGAAGGAGAGGGTACCCTACACTGATGACGGCCTAGAAGC
CATCATCTTCACGGCCCAGGGAGACATGAGGCAGGCGCTGAACAACCTGCAGTCCACCTTCTCAGGATTT
GGCTTCATTAACAGTGAGAACGTGTTCAAGGTCTGTGACGAGCCCCACCCACTGCTGGTAAAGGAGATGA
TCCAGCACTGTGTGAATGCCAACATTGACGAAGCCTACAAGATTCTTGCTCACTTGTGGCATCTGGGCTA
CTCACCAGAAGATATCATTGGCAACATCTTTCGAGTGTGTAAAACTTTCCAAATGGCAGAATACCTGAAA
CTGGAGTTTATCAAGGAAATTGGATACACTCACATGAAAATAGCGGAAGGAGTGAACTCTCTTTTGCAGA
TGGCAGGCCTCCTGGCAAGGCTGTGTCAGAAGACAATGGCCCCGGTGGCCAGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC236936 representing NM_001278792
Red=Cloning site Green=Tags(s)

MCPTSSLRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNA
SDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNLQSTFSGF
GFINSENVFKVCDEPHPLLVKEMIQHCVNANIDEAYKILAHLWHLGYSPEDIIGNIFRVCKTFQMAEYLK
LEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001278792
ORF Size 753 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001278792.1, NP_001265721.1
RefSeq Size 1652 bp
RefSeq ORF 756 bp
Locus ID 5982
Cytogenetics 7q11.23
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways DNA replication, Mismatch repair, Nucleotide excision repair
MW 28.8 kDa
Gene Summary 'This gene encodes a member of the activator 1 small subunits family. The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins, proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). Replication factor C, also called activator 1, is a protein complex consisting of five distinct subunits. This gene encodes the 40 kD subunit, which has been shown to be responsible for binding ATP and may help promote cell survival. Disruption of this gene is associated with Williams syndrome. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene of this gene has been defined on chromosome 2. [provided by RefSeq, Jul 2013]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.