RYK (NM_001005861) Human Tagged ORF Clone

CAT#: RC600067

  • TrueORF®

RYK (DDK-His-tagged)-Extra Cellular Domain Clone of Homo sapiens receptor-like tyrosine kinase, transcript variant 1, Signal peptide (1-25) plus EC domain (26-224)


  "NM_001005861" in other vectors (7)

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag DDK-His
Symbol RYK
Synonyms D3S3195; JTK5; JTK5A; RYK1
Vector pCMV6-XL5-DDK-His
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection None
Sequence Data
>RC600067 representing leader sequence plus the extracellular domain region of NM_001005861
Red=Cloning site Blue=ORF Green=Tags(s)

GTAATACGACTCACTATAGGGCGGCCGCGAATTCGTCGACTGGATCTGGTACCGAGGAGATCCGCCGCCG
CGATCGC
C

ATGCGTGGGGCGGCGCGGCTGGGGCGGCCGGGCCGGAGTTGCCTCCCGGGGGCCCGCGGCCTGAGGGCCC
CGCCGCCGCCGCCGCTGCTGCTTCTGCTTGCGCTGTTGCCGCTGCTGCCCGCGCCTGGCGCTGCCGCCGC
CCCCGCCCCGCGGCCCCCGGAGCTGCAGTCGGCTTCCGCGGGGCCCAGCGTGAGTCTCTACCTGAGCGAG
GACGAGGTGCGCCGGCTGATCGGTCTTGATGCAGAACTTTATTATGTGAGAAATGACCTTATTAGTCACT
ACGCTCTATCCTTTAGTCTGTTAGTACCCAGTGAGACAAATTTCCTGCACTTCACCTGGCATGCGAAGTC
CAAGGTTGAATATAAGCTGGGATTCCAAGTGGACAATGTTTTGGCAATGGATATGCCCCAGGTCAACATT
TCTGTTCAGGGGGAAGTTCCACGCACTTTATCAGTGTTTCGGGTAGAGCTTTCCTGTACTGGCAAAGTAG
ATTCTGAAGTTATGATACTAATGCAGCTCAACTTGACAGTAAATTCTTCAAAAAATTTTACCGTCTTAAA
TTTTAAACGAAGGAAAATGTGCTACAAAAAACTTGAAGAAGTAAAAACTTCAGCCTTGGACAAAAACACT
AGCAGAACTATTTATGATCCTGTACATGCAGCTCCAACCACTACGCGT


AGCGGACCGACGCGTTCAGGCGACTACAAGGATGACGACGATAAGGGATCTCATCATCACCATCACCATT
AA
TGAGATCTGGTACCGATATCAAGCTTGTCGACTCTAGA
>RC600067 representing signal peptide plus the extracellular domain region of NM_001005861
Red=Cloning sites Green= DDK and 6XHIS Tags

MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSE
DEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNI
SVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNT
SRTIYDPVHAAPTTTR

SGPTRTRSGDYKDDDDKGSHHHHHH
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene     
ACCN NM_001005861
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the extra cellular domain of the protein with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001005861.2, NP_001005861.1
RefSeq Size 2942 bp
RefSeq ORF 1833 bp
Locus ID 6259
Cytogenetics 3q22.2
Protein Families Druggable Genome, Protein Kinase, Transmembrane
MW 24.9 kDa
Gene Summary The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. The encoded protein has a leucine-rich extracellular domain with a WIF-type Wnt binding region, a single transmembrane domain, and an intracellular tyrosine kinase domain. This protein is involved in stimulating Wnt signaling pathways such as the regulation of axon pathfinding. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2012]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.