HIST1H4H (NM_003543) Human Tagged ORF Clone

CAT#: RG203098

  • TrueORF®

HIST1H4H (GFP-tagged) - Human histone cluster 1, H4h (HIST1H4H)


  "NM_003543" in other vectors (6)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "HIST1H4H"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol HIST1H4H
Synonyms H4/h; H4FH
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG203098 representing NM_003543
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGGCCGTGGTAAAGGTGGAAAAGGTTTGGGTAAGGGAGGAGCTAAGCGTCATCGCAAGGTTTTGC
GCGATAACATCCAGGGCATCACTAAGCCAGCTATCCGGCGCCTTGCTCGTCGCGGCGGTGTCAAGCGAAT
TTCTGGCCTTATCTATGAGGAGACTCGTGGTGTTCTGAAGGTGTTCCTGGAGAACGTGATTCGTGACGCT
GTCACTTACACAGAGCACGCCAAACGCAAGACCGTGACAGCAATGGATGTGGTCTACGCGCTGAAGCGAC
AGGGACGCACTCTTTACGGCTTCGGTGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG203098 representing NM_003543
Red=Cloning site Green=Tags(s)

MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDA
VTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003543
ORF Size 309 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_003543.3, NP_003534.1
RefSeq Size 374
RefSeq ORF 312
Locus ID 8365
Domains H4, histone
Protein Pathways Systemic lupus erythematosus
Gene Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq, Aug 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.