Stefin B (CSTB) (NM_000100) Human Tagged ORF Clone
CAT#: RG203872
- TrueORF®
CSTB (GFP-tagged) - Human cystatin B (stefin B) (CSTB)
"NM_000100" in other vectors (6)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Symbol | CSTB |
Synonyms | CPI-B; CST6; EPM1; EPM1A; PME; STFB; ULD |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG203872 representing NM_000100
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATGTGCGGGGCGCCCTCCGCCACGCAGCCGGCCACCGCCGAGACCCAGCACATCGCCGACCAGGTGA GGTCCCAGCTTGAAGAGAAAGAAAACAAGAAGTTCCCTGTGTTTAAGGCCGTGTCATTCAAGAGCCAGGT GGTCGCGGGGACAAACTACTTCATCAAGGTGCACGTCGGCGACGAGGACTTCGTACACCTGCGAGTGTTC CAATCTCTCCCTCATGAAAACAAGCCCTTGACCTTATCTAACTACCAGACCAACAAAGCCAAGCATGATG AGCTGACCTATTTC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA >RG203872 representing NM_000100
Red=Cloning site Green=Tags(s) MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVF QSLPHENKPLTLSNYQTNKAKHDELTYF TRTRPLE - GFP Tag - V |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_000100 |
ORF Size | 294 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_000100.2, NP_000091.1 |
RefSeq Size | 674 bp |
RefSeq ORF | 297 bp |
Locus ID | 1476 |
Cytogenetics | 21q22.3 |
Domains | CY |
Gene Summary | 'The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and kininogens. This gene encodes a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in this gene are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies. [provided by RefSeq, Jul 2016]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC100002 | CSTB (untagged)-Human cystatin B (stefin B) (CSTB) |
USD 310.00 |
|
RC203872 | CSTB (Myc-DDK-tagged)-Human cystatin B (stefin B) (CSTB) |
USD 98.00 |
|
RC203872L1 | Lenti ORF clone of Human cystatin B (stefin B) (CSTB), Myc-DDK-tagged |
USD 768.00 |
|
RC203872L2 | Lenti ORF clone of Human cystatin B (stefin B) (CSTB), mGFP tagged |
USD 768.00 |
|
RC203872L3 | Lenti ORF clone of Human cystatin B (stefin B) (CSTB), Myc-DDK-tagged |
USD 620.00 |
|
RC203872L4 | Lenti ORF clone of Human cystatin B (stefin B) (CSTB), mGFP tagged |
USD 768.00 |
{0} Product Review(s)
Be the first one to submit a review