Caveolin 3 (CAV3) (NM_001234) Human Tagged ORF Clone

CAT#: RG210118

  • TrueORF®

CAV3 (GFP-tagged) - Human caveolin 3 (CAV3), transcript variant 2


  "NM_001234" in other vectors (6)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "CAV3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CAV3
Synonyms LGMD1C; LQT9; MPDT; RMD2; VIP-21; VIP21
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG210118 representing NM_001234
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGCAGAAGAGCACACAGATCTCGAGGCCCAGATCGTCAAGGATATCCACTGCAAGGAGATTGACC
TGGTGAACCGAGACCCCAAGAACATTAATGAGGACATAGTCAAGGTGGATTTTGAAGACGTGATCGCAGA
GCCTGTGGGCACCTACAGCTTTGACGGCGTGTGGAAGGTGAGCTACACCACCTTCACTGTCTCCAAGTAC
TGGTGCTACCGTCTGTTGTCCACGCTGCTGGGCGTCCCACTGGCCCTGCTCTGGGGCTTCCTGTTCGCCT
GCATCTCCTTCTGCCACATCTGGGCGGTGGTGCCATGCATTAAGAGCTACCTGATCGAGATCCAGTGCAT
CAGCCACATCTACTCACTCTGCATCCGCACCTTCTGCAACCCACTCTTCGCGGCCCTGGGCCAGGTCTGC
AGCAGCATCAAGGTGGTGCTGCGGAAGGAGGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG210118 representing NM_001234
Red=Cloning site Green=Tags(s)

MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKY
WCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVC
SSIKVVLRKEV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001234
ORF Size 453 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001234.3, NP_001225.1
RefSeq Size 1329 bp
RefSeq ORF 456 bp
Locus ID 859
Cytogenetics 3p25.3
Protein Families Druggable Genome, Transmembrane
Protein Pathways Focal adhesion
Gene Summary 'This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. [provided by RefSeq, Jul 2008]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.