NPPC (NM_024409) Human Tagged ORF Clone

CAT#: RG211250

  • TrueORF®

NPPC (GFP-tagged) - Human natriuretic peptide C (NPPC)


  "NM_024409" in other vectors (4)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "NPPC"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol NPPC
Synonyms CNP; CNP2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG211250 representing NM_024409
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCATCTCTCCCAGCTGCTGGCCTGCGCCCTGCTGCTCACGCTGCTCTCCCTCCGGCCCTCCGAAGCCA
AGCCCGGGGCGCCGCCGAAGGTCCCGCGAACCCCGCCGGCAGAGGAGCTGGCCGAGCCGCAGGCTGCGGG
CGGCGGTCAGAAGAAGGGCGACAAGGCTCCCGGGGGCGGGGGCGCCAATCTCAAGGGCGACCGGTCGCGA
CTGCTCCGGGACCTGCGCGTGGACACCAAGTCGCGGGCAGCGTGGGCTCGCCTTCTGCAAGAGCACCCCA
ACGCGCGCAAATACAAAGGAGCCAACAAGAAGGGCTTGTCCAAGGGCTGCTTCGGCCTCAAGCTGGACCG
AATCGGCTCCATGAGCGGCCTGGGATGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG211250 representing NM_024409
Red=Cloning site Green=Tags(s)

MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSR
LLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024409
ORF Size 378 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024409.1, NP_077720.1
RefSeq Size 381 bp
RefSeq ORF 381 bp
Locus ID 4880
Cytogenetics 2q37.1
Domains ANP
Protein Families Secreted Protein
Gene Summary 'This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cardiac natriuretic peptides CNP-53, CNP-29 and CNP-22, which belong to the natriuretic family of peptides. The encoded peptides exhibit vasorelaxation activity in laboratory animals and elevated levels of CNP-22 have been observed in the plasma of chronic heart failure patients. [provided by RefSeq, Oct 2015]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.