Rabbit Polyclonal Anti-NPPC Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nppc antibody is: synthetic peptide directed towards the C-terminal region of Nppc. Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS |
Rabbit polyclonal anti C-Type Natriuretic Peptide (1-29) (ms, po, rat); neat antiserum
| Applications | ELISA |
| Reactivities | Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp- Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn- OH coupled to a carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (1-29) (ms, po, rt); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp- Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn- OH coupled to a carrier protein. |
Rabbit polyclonal anti human / porcine / rat C-Type Natriuretic Peptide (CNP) (32-53)
| Applications | ELISA |
| Reactivities | Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (32-53) (hu, po, rt); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH, (Disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (32-53) (hu, po, rt); diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH, (Disulfide bond) coupled to carrier protein. |
Germany
Japan
United Kingdom
China
