H2AFV (NM_201516) Human Tagged ORF Clone

CAT#: RG212727

  • TrueORF®

H2AFV (GFP-tagged) - Human H2A histone family, member V (H2AFV), transcript variant 4


  "NM_201516" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "H2AFV"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol H2AFV
Synonyms H2A.Z-2; H2AV
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG212727 representing NM_201516
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGAGGCAAAGCTGGAAAGGACAGTGGGAAGGCCAAGGCTAAGGCAGTATCTCGCTCACAGAGAG
CTGGGCTACAGTTTCCTGTGGGCCGCATCCACAGACACTTGAAGACTCGCACCACAAGCCATGGAAGGGT
GGGTGCCACTGCTGCCGTGTACAGTGCTGCGATTCTGGAGTACCTCACTGCAGAGGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG212727 representing NM_201516
Red=Cloning site Green=Tags(s)

MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_201516
ORF Size 198 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_201516.2, NP_958924.1
RefSeq Size 1299
RefSeq ORF 201
Locus ID 94239
Protein Families Druggable Genome
Protein Pathways Systemic lupus erythematosus
Gene Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq, Oct 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.