G protein alpha S (GNAS) (NM_016592) Human Tagged ORF Clone

CAT#: RG212804

  • TrueORF®

GNAS (GFP-tagged) - Human GNAS complex locus (GNAS), transcript variant 4


  "NM_016592" in other vectors (6)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "GNAS"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol GNAS
Synonyms AHO; C20orf45; GNAS1; GPSA; GSA; GSP; NESP; PITA3; POH; SCG6; SgVI
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG212804 representing NM_016592
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCGGAGGTCCCGGGCTCAGCAGTGGCGCCGAGCTCGCCATAATTACAACGACCTGTGCCCGCCCA
TAGGCCGCCGGGCAGCCACCGCGCTCCTCTGGCTCTCCTGCTCCATCGCGCTCCTCCGCGCCCTTGCCAC
CTCCAACGCCCGTGCCCAGCAGCGCGCGGCTGCCCAACAGCGCCGGAGCTTCCTTAACGCCCACCACCGC
TCCGGCGCCCAGGTATTCCCTGAGTCCCCCGAATCGGAATCTGACCACGAGCACGAGGAGGCAGACCTTG
AGCTGTCCCTCCCCGAGTGCCTAGAGTACGAGGAAGAGTTCGACTACGAGACCGAGAGCGAGACCGAGTC
CGAAATCGAGTCCGAGACCGACTTCGAGACCGAGCCTGAGACCGCCCCCACCACTGAGCCCGAGACCGAG
CCTGAAGACGATCGCGGCCCGGTGGTGCCCAAGCACTCCACCTTCGGCCAGTCCCTCACCCAGCGTCTGC
ACGCTCTCAAGTTGCGAAGCCCCGACGCCTCCCCAAGTCGCGCGCCGCCCAGCACTCAGGAGCCCCAGAG
CCCCAGGGAAGGGGAGGAGCTCAAGCCCGAGGACAAAGATCCAAGGGACCCCGAAGAGTCGAAGGAGCCC
AAGGAGGAGAAGCAGCGGCGTCGCTGCAAGCCAAAGAAGCCCACCCGCCGTGACGCGTCCCCGGAGTCCC
CTTCCAAAAAGGGACCCATCCCCATCCGGCGTCAC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG212804 representing NM_016592
Red=Cloning site Green=Tags(s)

MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHR
SGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETE
PEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEP
KEEKQRRRCKPKKPTRRDASPESPSKKGPIPIRRH

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016592
ORF Size 735 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016592.1, NP_057676.1
RefSeq Size 2566 bp
RefSeq ORF 738 bp
Locus ID 2778
Cytogenetics 20q13.32
Domains G-alpha
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Calcium signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Long-term depression, Melanogenesis, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection
Gene Summary 'This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contain a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq, Aug 2012]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.