RNF98 (TRIM36) (NM_001017397) Human Tagged ORF Clone

CAT#: RG216273

  • TrueORF®

TRIM36 (GFP-tagged) - Human tripartite motif containing 36 (TRIM36), transcript variant 2


  "NM_001017397" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "TRIM36"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol TRIM36
Synonyms ANPH; HAPRIN; RBCC728; RNF98
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG216273 representing NM_001017397
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGAGTCTGGGGAGATGAGTGAATTTGGCTACATCATGGAATTGATAGCTAAAGGCAAGATGCCGG
ATTGGAGACGAGGCTACCGCTGCAGACAGGGCTGTGGGAAGACGACGGAACTTGCCACAGCGACAGACTT
CTCCCAAACAGGAAATAAAAGTGGGAAGCATTTTAAAACC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG216273 representing NM_001017397
Red=Cloning site Green=Tags(s)

MSESGEMSEFGYIMELIAKGKMPDWRRGYRCRQGCGKTTELATATDFSQTGNKSGKHFKT

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001017397
ORF Size 180 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001017397.1, NP_001017397.1
RefSeq Size 760
RefSeq ORF 183
Locus ID 55521
Protein Families Druggable Genome
Gene Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.