SPTLC1 (NM_178324) Human Tagged ORF Clone

CAT#: RG216310

  • TrueORF®

SPTLC1 (GFP-tagged) - Human serine palmitoyltransferase, long chain base subunit 1 (SPTLC1), transcript variant 2


  "NM_178324" in other vectors (4)

Reconstitution Protocol

USD 570.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "SPTLC1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SPTLC1
Synonyms HSAN1; HSN1; LBC1; LCB1; SPT1; SPTI
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG216310 representing NM_178324
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGACCGCCACGGAGCAGTGGGTTCTGGTGGAGATGGTACAGGCGCTTTACGAGGCTCCTGCTTACC
ATCTTATTTTGGAAGGGATTCTGATCCTCTGGATAATCAGACTTCTTTTCTCTAAGACTTACAAATTACA
AGAACGATCTGATCTTACAGTCAAGGAAAAAGAAGAACTGATTGAAGAGTGGCAACCAGAACCTCTTGTT
CCTCCTGTCCCAAAAGACCATCCTGCTCTCAACTACAACATCGTTTCAGGCCCTCCAAGCCACAAAACTG
TGGTGAATGGAAAAGAATGTATAAACTTCGCCTCATTTAATTTTCTTGGATTGTTGGATAACCCTAGGGT
TAAGGCAGCAGCTTTAGCATCTCTAAAGAAGTATGGCGTGGGGACTTGTGGACCCAGAGGATTTTATGGC
ACATTTGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG216310 representing NM_178324
Red=Cloning site Green=Tags(s)

MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLV
PPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYG
TFE

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_178324
ORF Size 429 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_178324.1, NP_847894.1
RefSeq Size 998
RefSeq ORF 432
Locus ID 10558
Protein Families Druggable Genome, Transmembrane
Protein Pathways Metabolic pathways, Sphingolipid metabolism
Gene Summary This gene encodes a member of the class-II pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is the long chain base subunit 1 of serine palmitoyltransferase. Serine palmitoyltransferase converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate and is the key enzyme in sphingolipid biosynthesis. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified. Pseudogenes of this gene have been defined on chromosomes 1, 6, 10, and 13. [provided by RefSeq, Jul 2013]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.