PRB1 (NM_199354) Human Tagged ORF Clone

CAT#: RG219911

  • TrueORF®

PRB1 (GFP-tagged) - Human proline-rich protein BstNI subfamily 1 (PRB1), transcript variant 3


  "NM_199354" in other vectors (6)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "PRB1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol PRB1
Synonyms PM; PMF; PMS; PRB1L; PRB1M
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG219911 representing NM_199354
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTTGATTCTGCTGTCAGTGGCCTTGCTGGCCCTGAGCTCAGCTCAGAACTTAAATGAAGATGTCA
GCCAGGAAGAATCTCCCTCCCTAATAGCAGGAAATCCACAAGGACCATCCCCACAAGGAGGCAACAAGCC
CCAAGGCCCCCCACCTCCTCCAGGAAAGCCACAAGGACCACCCCCACAAGGAGGCAACAAACCTCAAGGT
CCCCCACCTCCAGGAAAGCCACAAGGACCACCCCCACAAGGGGACAAGTCCCGAAGTCCCCGATCTCCTC
CAGGAAAACCACAAGGACCACCCCCACAAGGAGGAAAGCCACAAGGACCACCCGCACAAGGAGGCAGCAA
GTCCCAAAGTGCCCGATCTCCTCCAGGAAAGCCACAAGGACCACCCCAACAAGAAGGCAACAATCCTCAA
GGTCCCCCACCTCCAGCAGGAGGCAATCCCCAGCAGCCTCAGGCACCTCCTGCTGGACAGCCCCAGGGAC
CACCACGCCCTCCTCAAGGGGGCAGACCTTCCAGACCTCCCCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG219911 representing NM_199354
Red=Cloning site Green=Tags(s)

MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGPSPQGGNKPQGPPPPPGKPQGPPPQGGNKPQG
PPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGKPQGPPAQGGSKSQSARSPPGKPQGPPQQEGNNPQ
GPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_199354
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_199354.1, NP_955386.1
RefSeq Size 714 bp
RefSeq ORF 537 bp
Locus ID 5542
Cytogenetics 12p13.2
Protein Families Druggable Genome
Gene Summary 'This gene encodes a member of the heterogeneous family of basic, proline-rich, human salivary glycoproteins. The encoded preproprotein undergoes proteolytic processing to generate one or more mature peptides before secretion from the parotid glands. Multiple alleles of this gene exhibiting variations in the length of the tandem repeats have been identified. The reference genome encodes the "Medium" allele. This gene is located in a cluster of closely related salivary proline-rich proteins on chromosome 12. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Nov 2015]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.