Histone H2A Bbd (H2AFB3) (NM_080720) Human Tagged ORF Clone

CAT#: RG220561

  • TrueORF®

H2AFB3 (GFP-tagged) - Human H2A histone family, member B3 (H2AFB3)


  "NM_080720" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "H2AFB3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol H2AFB3
Synonyms H2ABBD; H2AFB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG220561 representing NM_080720
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGAGGAGGAGGAGACGCCGAGGGTCCTCCGGTGCTGGCGGCCGGGGGCGGACCTGCTCTCGCACCG
TCCGAGCGGAGCTTTCGTTTTCAGTGAGCCAGGTGGAGCGCAGTCTACGGGAGGGCCACTACGCTCAGCG
CCTGAGTCGCACGGCGCCGGTCTACCTCGCTGCGGTTATTGAGTACCTGACGGCCAAGGTCCTGGAGCTG
GCGGGCAACGAGGCCCAGAACAGCGGAGAGCGGAACATCACTCCCCTGCTGCTGGACATGGTGGTTCACA
ACGACAGGCTACTGAGCACCCTTTTCAACACGACCACCATCTCTCAAGTGGCCCCTGGCGAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG220561 representing NM_080720
Red=Cloning site Green=Tags(s)

MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL
AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_080720
ORF Size 345 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_080720.1, NP_542451.1
RefSeq Size 539
RefSeq ORF 348
Locus ID 83740
Protein Pathways Systemic lupus erythematosus
Gene Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the most telomeric copy. [provided by RefSeq, Oct 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.