Cytochrome b5 (CYB5A) (NM_001914) Human Tagged ORF Clone

CAT#: RG221889

  • TrueORF®

CYB5A (GFP-tagged) - Human cytochrome b5 type A (microsomal) (CYB5A), transcript variant 2


  "NM_001914" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "CYB5A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CYB5A
Synonyms CYB5; MCB5; METAG
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG221889 representing NM_001914
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGCAGTCGGACGAGGCCGTGAAGTACTACACCCTAGAGGAGATTCAGAAGCACAACCACAGCA
AGAGCACCTGGCTGATCCTGCACCACAAGGTGTACGATTTGACCAAATTTCTGGAAGAGCATCCTGGTGG
GGAAGAAGTTTTAAGGGAACAAGCTGGAGGTGACGCTACTGAGAACTTTGAGGATGTCGGGCACTCTACA
GATGCCAGGGAAATGTCCAAAACATTCATCATTGGGGAGCTCCATCCAGATGACAGACCAAAGTTAAACA
AGCCTCCGGAACCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221889 representing NM_001914
Red=Cloning site Green=Tags(s)

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST
DAREMSKTFIIGELHPDDRPKLNKPPEP

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001914
ORF Size 294 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001914.3, NP_001905.1
RefSeq Size 874 bp
RefSeq ORF 297 bp
Locus ID 1528
Cytogenetics 18q22.3
Domains heme_1
Protein Families Transmembrane
Gene Summary 'The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.