PTPN20B (PTPN20) (NM_001042365) Human Tagged ORF Clone

CAT#: RG223428

  • TrueORF®

PTPN20B (GFP-tagged) - Human protein tyrosine phosphatase, non-receptor type 20B (PTPN20B), transcript variant 10


  "NM_001042365" in other vectors (4)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "PTPN20"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol PTPN20
Synonyms bA42B19.1; bA142I17.1; CT126; PTPN20A; PTPN20B
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG223428 representing NM_001042365
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGGACAGCCAGAGGCCCCTTCAGAAGAGACAGGTGGAGCAGTGAGGATGAGGAGGCTGCAGGGCCAT
CACAGGCTCTCTCCCCTCTACTTTCTGTTCAACATCATGGATATAGTGGCCCAAATGAGAGAACAACGTT
CTGGCATGGTTCAAACGAAGGAGCAGTATCACTTTTGTTACGATATTGTGCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG223428 representing NM_001042365
Red=Cloning site Green=Tags(s)

MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001042365
ORF Size 192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001042365.2, NP_001035824.1
RefSeq Size 1885
RefSeq ORF 195
Locus ID 26095
Protein Families Druggable Genome, Phosphatase
Gene Summary The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes. The encoded protein appears to be targeted to sites of actin polymerization. A pseudogene of this gene has been defined on chromosome 10. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.