Sumo 2 (SUMO2) (NM_006937) Human Tagged ORF Clone
CAT#: RG224336
- TrueORF®
SUMO2 (GFP-tagged) - Human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1
"NM_006937" in other vectors (6)
Product Images
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | TurboGFP |
Symbol | SUMO2 |
Synonyms | HSMT3; Smt3A; SMT3B; SMT3H2; SUMO3 |
Vector | pCMV6-AC-GFP |
E. coli Selection | Ampicillin (100 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RG224336 representing NM_006937
Red=Cloning site Green=Tags(s) MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINET DTPAQLEMEDEDTIDVFQQQTGGVY TRTRPLE - GFP Tag - V |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_006937 |
ORF Size | 285 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_006937.3, NP_008868.3 |
RefSeq Size | 1066 bp |
RefSeq ORF | 288 bp |
Locus ID | 6613 |
Cytogenetics | 17q25.1 |
Domains | UBQ |
Protein Families | Druggable Genome |
Gene Summary | 'This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]' |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
SC115793 | SUMO2 (untagged)-Human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1 |
USD 310.00 |
|
RC224336 | SUMO2 (Myc-DDK-tagged)-Human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1 |
USD 420.00 |
|
RC224336L1 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1, Myc-DDK-tagged |
USD 768.00 |
|
RC224336L2 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1, mGFP tagged |
USD 620.00 |
|
RC224336L3 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1, Myc-DDK-tagged |
USD 620.00 |
|
RC224336L4 | Lenti ORF clone of Human SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae) (SUMO2), transcript variant 1, mGFP tagged |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review