GHRH (NM_001184731) Human Tagged ORF Clone

CAT#: RG229537

GHRH (GFP-tagged) - Human growth hormone releasing hormone (GHRH), transcript variant 2

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: GHRH
• Synonyms: GHRF; GRF; INN
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG229537 representing NM_001184731
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCACTCTGGGTGTTCTTCTTTGTGATCCTCACCCTCAGCAACAGCTCCCACTGCTCCCCACCTCCCC
  CTTTGACCCTCAGGATGCGGCGGTATGCAGATGCCATCTTCACCAACAGCTACCGGAAGGTGCTGGGCCA
  GCTGTCCGCCCGCAAGCTGCTCCAGGACATCATGAGCAGGCAGCAGGGAGAGAGCAACCAAGAGCGAGGA
  GCAAGGGCACGGCTTGGTCGTCAGGTAGACAGCATGTGGGCAGAACAAAAGCAAATGGAATTGGAGAGCA
  TCCTGGTGGCCCTGCTGCAGAAGCACAGGAACTCCCAGGGA
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG229537 representing NM_001184731
  Red=Cloning site Green=Tags(s)
  
  MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERG
  ARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001184731
• ORF Size: 321 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001184731.1, NP_001171660.1
• RefSeq Size: 459 bp
• RefSeq ORF: 324 bp
• Locus ID: 2691
• Cytogenetics: 20q11.23
• Protein Families: Druggable Genome, Secreted Protein
• Gene Summary: 'This gene encodes a member of the glucagon family of proteins. The encoded preproprotein is produced in the hypothalamus and cleaved to generate the mature factor, known as somatoliberin, which acts to stimulate growth hormone release from the pituitary gland. Variant receptors for somatoliberin have been found in several types of tumors, and antagonists of these receptors can inhibit the growth of the tumors. Defects in this gene are a cause of dwarfism, while hypersecretion of the encoded protein is a cause of gigantism. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016]'