Cytochrome P450 3A5 (CYP3A5) (NM_001190484) Human Tagged ORF Clone

CAT#: RG230978

  • TrueORF®

CYP3A5 (GFP-tagged) - Human cytochrome P450, family 3, subfamily A, polypeptide 5 (CYP3A5), transcript variant 2


  "NM_001190484" in other vectors (3)

Reconstitution Protocol

USD 460.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "CYP3A5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol CYP3A5
Synonyms CP35; CYPIIIA5; P450PCN3; PCN3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG230978 representing NM_001190484
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCTCATCCCAAATTTGGCGGTGGAAACCTGGCTTCTCCTGGCTGTCAGCCTGGTGCTCCTCTATC
TATATGGGACCCGTACACATGGACTTTTTAAGAGACTGGGAATTCCAGGGCCCACACCTCTGCCTTTGTT
GGGAAATGTTTTGTCCTATCGTCAGGGTCTCTGGAAATTTGACACAGAGTGCTATAAAAAGTATGGAAAA
ATGTGGGGAACGTATGAAGGTCAACTCCCTGTGCTGGCCATCACAGATCCCGACGTGATCAGAACAGTGC
TAGTGAAAGAATGTTATTCTGTCTTCACAAATCGAAGGATTTGTGCAACGACCAGCACCATCAAGATGCA
GACCCATTCCGTCACCATGTGGCTCCCTCCTGCTGTCCTACAGTCACAACATGGAGTTTGTCTTTTTCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG230978 representing NM_001190484
Red=Cloning site Green=Tags(s)

MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFDTECYKKYGK
MWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRICATTSTIKMQTHSVTMWLPPAVLQSQHGVCLFL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001190484
ORF Size 420 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001190484.1, NP_001177413.1
RefSeq Size 1077 bp
RefSeq ORF 423 bp
Locus ID 1577
Cytogenetics 7q22.1
Protein Families Druggable Genome, P450, Transmembrane
Protein Pathways Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Linoleic acid metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism
Gene Summary 'This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The encoded protein metabolizes drugs as well as the steroid hormones testosterone and progesterone. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Two pseudogenes of this gene have been identified within this cluster on chromosome 7. Expression of this gene is widely variable among populations, and a single nucleotide polymorphism that affects transcript splicing has been associated with susceptibility to hypertensions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]'

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.