GADD45A (NM_001199742) Human Tagged ORF Clone

CAT#: RG231520

GADD45A (GFP-tagged) - Homo sapiens growth arrest and DNA-damage-inducible, alpha (GADD45A), transcript variant 3

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: GADD45A
• Synonyms: DDIT1; GADD45
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG231520 representing NM_001199742
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACTTTGGAGGAATTCTCGGCTGGAGAGCAGAAGACCGAAAGGATGGATAAGGTGGGGGATGCCCTGG
  AGGAAGTGCTCAGCAAAGCCCTGAGTCAGCGCACGATCACTGTCGGGGTGTACGAAGCGGCCAAGCTGCT
  CAACGTAATCCACATTCATCTCAATGGAAGGATCCTGCCT
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG231520 representing NM_001199742
  Red=Cloning site Green=Tags(s)
  
  MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVIHIHLNGRILP
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001199742
• ORF Size: 180 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001199742.1, NP_001186671.1
• RefSeq Size: 1160 bp
• RefSeq ORF: 183 bp
• Locus ID: 1647
• Cytogenetics: 1p31.3
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, MAPK signaling pathway, p53 signaling pathway
• Gene Summary: 'This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]'