Macrophage Inflammatory Protein 1 beta (CCL4L2) (NM_001291472) Human Tagged ORF Clone

CAT#: RG235574

  • TrueORF®

CCL4L2 (GFP-tagged) - Human chemokine (C-C motif) ligand 4-like 2 (CCL4L2), transcript variant CCL4L2d


Reconstitution Protocol

USD 460.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "CCL4L2"

Specifications

Product Data
Tag TurboGFP
Symbol CCL4L2
Synonyms AT744.2; CCL4L; SCYA4L; SCYQ4L2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG235574 representing NM_001291472.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGAAGCTCTGCGTGACTGTCCTGTCTCTCCTCGTGCTAGTAGCTGCCTTCTGCTCTCTAGCACTCTCA
GCACCAATGGGCTCAGACCCTCCCACCGCCTGCTGCTTTTCTTACACCGCGAGGAAGCTTCCTCGCAAC
TTTGTGGTAGATTACTATGAGACCAGCAGCCTCTGCTCCCAGCCAGCTGTGGTTGCTGCTCCGGGAAGG
ATCCCATCCACCAGAGCTGCCCCACATGGACCATGGTCAGGCAGAGGAAGATGCCTACCACAGGCAAGG
GATAAAGCCAGA

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAAAC
>Peptide sequence encoded by RG235574
Blue=ORF Red=Cloning site Green=Tag(s)

MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVAAPGR
IPSTRAAPHGPWSGRGRCLPQARDKAR

TRTRPLEMESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKMKSTKGALTFSPYLLSHV
MGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVLHVSFSYRYEAGRVIGDFKVMGTGFPED
SVIFTDKIIRSNATVEHLHPMGDNDLDGSFTRTFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFA
FRRVEEDHSNTELGIVEYQHAFKTPDADAGEERV

Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001291472
ORF Size 288 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001291472.2
RefSeq Size 815 bp
RefSeq ORF 291 bp
Locus ID 9560
Cytogenetics 17q12
Protein Families Druggable Genome, Transmembrane
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway
MW 10.7 kDa
Gene Summary This gene is one of several cytokine genes that are clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins that function in inflammatory and immunoregulatory processes. The protein encoded by this family member is similar to the chemokine (C-C motif) ligand 4 product, which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals, where most individuals have one to five copies. This gene copy contains a non-consensus splice acceptor site at the 3' terminal exon found in other highly similar gene copies, and it thus uses other alternative splice sites for the 3' terminal exon, resulting in multiple transcript variants. [provided by RefSeq, Apr 2014]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.