Gpx4 (NM_001039849) Rat Tagged ORF Clone

CAT#: RR200392

Gpx4 (Myc-DDK-tagged ORF) - Rat glutathione peroxidase 4 (Gpx4), transcript variant 2, (10 ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Symbol: Gpx4
• Synonyms: gpx-4; Gshpx-4; Phgpx; snGpx
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR200392 representing NM_001039849
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCCGCGCGGCCGCCCGCAAGCGGGGACGCTGCAGACAGCGCGGCCGGTCCCCGGGAGGCCGGCGAC
  GGCGTGAACCTGGACGCCAAAGTCCTAGGAAGCGCCCAGGCCCTCGGAGGAGGAGAGCTCGCGCGCGCCG
  CCGCAGGAGGGCGCGCCCTCGCCGGATGGAGCCCATTCCCGAGCCTTTCAACCCGCGGCCTCTGCTGCAG
  GACCTTCCCCAGACCAGCAACAGCCACGAGTTCCTGGGCTTGTGTGCATCCCGCGATGATTGGCGCTGTG
  CGCGCTCCATGCACGAATTCGCAGCCAAGGACATCGATGGGCACATGGTTTGCCTGGATAAGTACAGGGG
  TTGCGTGTGCATCGTCACCAACGTGGCCTCGCAATGAGGCAAAACCGACGTAAACTACACTCAGCTAGTC
  GATCTGCATGCCCGATACGCCGAGTGTGGTTTACGAATCCTGGCCTTCCCTTGCAACCAGTTCGGGAGGC
  AGGAGCCAGGAAGTAATCAAGAAATCAAGGAGTTTGCAGCCGGCTACAATGTCAGGTTTGACATGTACAG
  CAAGATCTGTGTAAATGGGGACGATGCCCACCCACTGTGGAAATGGATGAAAGTCCAGCCCAAGGGCAGG
  GGCATGCTGGGAAATGCCATCAAATGGAACTTTACCAAGTTTCTCATTGATAAGAACGGCTGCGTGGTGA
  AGCGCTATGGTCCCATGGAGGAGCCCCAGGTGATAGAGAAGGACCTGCCGTGCTATCTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR200392 representing NM_001039849
  Red=Cloning site Green=Tags(s)
  
  MGRAAARKRGRCRQRGRSPGGRRRREPGRQSPRKRPGPRRRRARARRRRRARPRRMEPIPEPFNPRPLLQ
  DLPQTSNSHEFLGLCASRDDWRCARSMHEFAAKDIDGHMVCLDKYRGCVCIVTNVASQ*GKTDVNYTQLV
  DLHARYAECGLRILAFPCNQFGRQEPGSNQEIKEFAAGYNVRFDMYSKICVNGDDAHPLWKWMKVQPKGR
  GMLGNAIKWNFTKFLIDKNGCVVKRYGPMEEPQVIEKDLPCYL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001039849
• ORF Size: 759 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
• OTI Annotation: This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.

Reference Data

• RefSeq: NM_001039849.1, NM_001039849.2, NP_001034938.1
• RefSeq Size: 1037
• RefSeq ORF: 762
• Locus ID: 29328
• MW: 29.3 kDa
• Gene Summary: The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme has a high preference for lipid hydroperoxides and protects cells against membrane lipid peroxidation and cell death. It is also required for normal sperm development; thus, it has been identified as a 'moonlighting' protein because of its ability to serve dual functions as a peroxidase, as well as a structural protein in mature spermatozoa. Disruption of this gene in mouse spermatocytes is associated with male infertility. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Transcript variants resulting from alternative splicing or use of alternate promoters have been described to encode isoforms with different subcellular localization. Pseudogenes of this locus have been identified on chromosomes 1, 10 and 14. [provided by RefSeq, Jan 2019]