Gpx2 (NM_183403) Rat Tagged ORF Clone

CAT#: RR204828

Gpx2 (Myc-DDK-tagged ORF) - Rat glutathione peroxidase 2 (Gpx2), (10 ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Symbol: Gpx2
• Synonyms: GPX-GI; GSHPx-2; GSHPx-GI
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR204828 representing NM_183403
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCTTACATCGCCAAGTCTTTTTACGATCTCAGTGCCATCGGCCTGGATGGGGAGAAGATAGACTTCA
  ACACGTTCCGAGGCAGGGCCGTGCTGATTGAGAATGTGGCCTCGCTCTGAGGAACAACTACCCGGGACTA
  CACCCAGCTCAATGAGTTGCAGTGCCGCTTTCCCAGGCGCCTAGTGGTTCTCGGCTTCCCTTGCAACCAG
  TTCGGACATCAGGAGAACTGTCAGAATGAGGAGATCCTGAACAGCCTCAAGTATGTCCGCCCTGGGGGTG
  GGTTCCAGCCCACCTTCAGTCTTACCCAAAAGTGTGATGTCAATGGGCAGAATCAGCATCCTGTCTTTGC
  CTACCTGAAAGACAAGCTGCCCTACCCTTATGACGACCCATTCTCCCTCATGACCGATCCCAAGCTCATC
  ATATGGAGTCCGGTGCGCCGCTCAGATGTGTCCTGGAACTTTGAGAAGTTCCTCATAGGGCCAGAAGGGG
  AGCCTTTCCGTCGCTACAGCCGCACCTTCCAGACCATCAACATCGAGCCTGACATCAAACGTCTCCTCAA
  AGTTGCCATC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR204828 representing NM_183403
  Red=Cloning site Green=Tags(s)
  
  MAYIAKSFYDLSAIGLDGEKIDFNTFRGRAVLIENVASL*GTTTRDYTQLNELQCRFPRRLVVLGFPCNQ
  FGHQENCQNEEILNSLKYVRPGGGFQPTFSLTQKCDVNGQNQHPVFAYLKDKLPYPYDDPFSLMTDPKLI
  IWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRTFQTINIEPDIKRLLKVAI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_183403
• ORF Size: 570 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
• OTI Annotation: This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.

Reference Data

• RefSeq: NM_183403.1, NM_183403.2, NP_899653.2
• RefSeq Size: 1028
• RefSeq ORF: 573
• Locus ID: 29326
• MW: 21.9 kDa
• Gene Summary: The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is predominantly expressed in the gastrointestinal tract in rodents, is localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. Knockout studies in mice lacking this gene suggest a role for this isozyme in intestinal inflammation and colon cancer development. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Pseudogenes of this locus have been identified on chromosomes 2 and X. [provided by RefSeq, Aug 2017]