Pcp4 (NM_013002) Rat Tagged ORF Clone

CAT#: RR207279

Pcp4 (Myc-DDK-tagged ORF) - Rat Purkinje cell protein 4 (Pcp4), (10 ug)

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Pcp4
• Synonyms: pep-19; PEPZ19
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR207279 representing NM_013002
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGTGAGAGACAAAGTGCTGGAGCGACCAATGGAAAAGACAAGACATCAGGAGATAATGATGGGCAGA
  AGAAGGTCCAAGAAGAATTTGATATCGACATGGATGCACCAGAGACAGAGCGTGCAGCTGTGGCCATTCA
  GTCTCAGTTCAGAAAATTCCAGAAGAAAAAGGCAGGATCACAGTCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR207279 representing NM_013002
  Red=Cloning site Green=Tags(s)
  
  MSERQSAGATNGKDKTSGDNDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_013002
• ORF Size: 186 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_013002.1, NM_013002.2, NM_013002.3, NM_013002.4, NP_037134.1
• RefSeq Size: 571
• RefSeq ORF: 189
• Locus ID: 25510
• MW: 6.8 kDa
• Gene Summary: The protein encoded by this gene regulates H1˚ and H3.3 histone synthesis by binding to H1˚ and H3.3 histone mRNAs. The encoded protein can bind calmodulin as well, providung a possible link between calcium-dependent signals and histone metabolism. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012]