Selenoh (NM_001114939) Rat Tagged ORF Clone

CAT#: RR210725

RGD1563348 (Myc-DDK-tagged ORF) - Rat similar to Selenoprotein H (RGD1563348), (10 ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Symbol: Selenoh
• Synonyms: RGD1563348; Selh
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR210725 representing NM_001114939
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCCCTCTCGGAAGAAAGCGTAAGGCCGGGGCCGCGCCTATCGAGTCGGCGGACAAGCGCGAGAAAC
  TGGCGGAGGGCGCGGCCGTGGTCATTGAGCATTGTACGAGCTGACGTGTCTACGGCCGCCATGCTGCTGC
  CCTGAGCCAGGCTCTGCAACTGGAGGCCCCAGAGATATCTGTGCAAGTGAACCGGTCCAAGCCGCGGAGG
  GGCAGCTTCGAAGTGACGCTGCTGCGCCCGGACAACAGTCGTGTTGAACTCTGGACTGGTATTAAGAAGG
  GCCCTCCACGAAAGCTCAAATTTCCTGAGCCTCAAGAGATGGTTGAAGAATTGAAGAAGTACCTTTCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR210725 representing NM_001114939
  Red=Cloning site Green=Tags(s)
  
  MAPLGRKRKAGAAPIESADKREKLAEGAAVVIEHCTS*RVYGRHAAALSQALQLEAPEISVQVNRSKPRR
  GSFEVTLLRPDNSRVELWTGIKKGPPRKLKFPEPQEMVEELKKYLS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001114939
• ORF Size: 348 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
• OTI Annotation: This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.

Reference Data

• RefSeq: NM_001114939.1, NM_001114939.2, NP_001108411.1
• RefSeq Size: 678
• RefSeq ORF: 351
• Locus ID: 502642
• MW: 12.9 kDa
• Gene Summary: This gene encodes a nucleolar protein, which belongs to the SelWTH family. It functions as an oxidoreductase, and has been shown to protect neurons against UVB-induced damage by inhibiting apoptotic cell death pathways, promote mitochondrial biogenesis and mitochondrial function, and suppress cellular senescence through genome maintenance and redox regulation. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, May 2016]