Cox7c (NM_001134705) Rat Tagged ORF Clone

CAT#: RR213356

Cox7c (Myc-DDK-tagged ORF) - Rat cytochrome c oxidase, subunit VIIc (Cox7c), nuclear gene encoding mitochondrial protein, (10 ug)

Specifications

Product Data

• Type: Rat Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cox7c
• Synonyms: Cox7c1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RR213356 representing NM_001134705
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTGGGCCAGAGTATCCGGAGGTTCACCACCTCCGTGGTGCGTCGCAGCCACTATGAGGAGGGTCCGG
  GGAAGAATTTGCCGTTTTCAGTGGAAAACAAGTGGCGGTTACTGCTTATGATGACCGTGTACTTTGGATC
  TGGATTTGCTGCTCCTTTCTTTATAGTAAGGCACCAGCTACTTAAAAAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RR213356 representing NM_001134705
  Red=Cloning site Green=Tags(s)
  
  MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWRLLLMMTVYFGSGFAAPFFIVRHQLLKK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001134705
• ORF Size: 189 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001134705.1, NP_001128177.1
• RefSeq Size: 492
• RefSeq ORF: 192
• Locus ID: 100188937
• MW: 7.4 kDa
• Gene Summary: This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. [UniProtKB/Swiss-Prot Function]