Cox8c (NM_183055) Rat Tagged ORF Clone

CAT#: RR213568

  • TrueORF®

Cox8c (Myc-DDK-tagged ORF) - Rat cytochrome c oxidase, subunit 8C (Cox8c), nuclear gene encoding mitochondrial protein, (10 ug)


  "NM_183055" in other vectors (3)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Cox8c"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Cox8c
Synonyms COXVIII-3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR213568 representing NM_183055
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCGCTTGCTGCAGTTCTGCTCTTCCCTCCTCCGACACCGTGTAGTCCTGTTCTCGAAGCCTGGCC
ACTCAGGCCGCCTCAGCCACTCAGAAAGCCCACAAAACCAAGTCCTGACACCCACGGAATCGGTTGTTGG
AATTGTCGTGTTTTTTGCCACCTTTTTCATCCCAGCTGCGTATGTGATGAGCAACCTGAAGTTTTTCAAA
GGCGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR213568 representing NM_183055
Red=Cloning site Green=Tags(s)

MSRLLQFCSSLLRHRVVLFSKPGHSGRLSHSESPQNQVLTPTESVVGIVVFFATFFIPAAYVMSNLKFFK
GE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_183055
ORF Size 216 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_183055.1, NP_898878.1
RefSeq Size 548
RefSeq ORF 219
Locus ID 360229
MW 8.1 kDa
Gene Summary This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.