Dbi (NM_031853) Rat Tagged ORF Clone

CAT#: RR214369

  • TrueORF®

Dbi (Myc-DDK-tagged ORF) - Rat diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (Dbi), (10 ug)


  "NM_031853" in other vectors (3)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Dbi
Synonyms Acbp; Acoabp3; Ep; Odn; RNACOABP3; Ttn
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR214369 representing NM_031853
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTCAGGCTGATTTCGACAAAGCCGCTGAGGAGGTGAAGCGCCTCAAGACTCAGCCAACTGATGAAG
AGATGCTGTTCATCTACAGCCACTTCAAACAAGCTACTGTGGGCGATGTAAACACAGATCGGCCGGGGCT
GTTGGACCTCAAGGGCAAAGCCAAGTGGGACTCGTGGAACAAGCTGAAAGGAACTTCCAAGGAAAATGCC
ATGAAGACCTATGTGGAAAAGGTAGAAGAGCTAAAGAAGAAATATGGAATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR214369 representing NM_031853
Red=Cloning site Green=Tags(s)

MSQADFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKENA
MKTYVEKVEELKKKYGI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_031853
ORF Size 261 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_031853.1, NM_031853.2, NM_031853.3, NM_031853.4, NP_114054.1
RefSeq Size 593
RefSeq ORF 264
Locus ID 25045
MW 10 kDa
Gene Summary plays a role in the regulation of mitochondrial steroidogenesis and acyl-CoA metabolism [RGD, Feb 2006]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.