Pcp4 (NM_001270538) Rat Tagged ORF Clone

CAT#: RR215788

  • TrueORF®

Pcp4 (myc-DDK-tagged) - Rat Purkinje cell protein 4 (Pcp4), transcript variant 2


  "NM_001270538" in other vectors (1)

Reconstitution Protocol

USD 420.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Pcp4"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Pcp4
Synonyms pep-19; PEPZ19
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR215788 representing NM_001270538
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAAGACAAGACATCAGGAGATAATGGCAAAGTGCTCACTGCCAGAGGAGGAATGGAGAAGTGCCT
GGCACGATCCAGCCAGAACCTGCTCGGTCTCTAAGAAAGCCAAGAGGATCTGCAGTGGAAATGCCTCGCT
GGAGGCTCCTGAAATATATGGGCAGAAGAAGGTCCAAGAAGAATTTGATATCGACATGGATGCACCAGAG
ACAGAGCGTGCAGCTGTGGCCATTCAGTCTCAGTTCAGAAAATTCCAGAAGAAAAAGGCAGGATCACAGT
CC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR215788 representing NM_001270538
Red=Cloning site Green=Tags(s)

MEKTRHQEIMAKCSLPEEEWRSAWHDPARTCSVSKKAKRICSGNASLEAPEIYGQKKVQEEFDIDMDAPE
TERAAVAIQSQFRKFQKKKAGSQS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001270538
ORF Size 282 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001270538.1, NM_001270538.2, NP_001257467.1
RefSeq Size 698
RefSeq ORF 285
Locus ID 25510
MW 10.7 kDa
Gene Summary The protein encoded by this gene regulates H1˚ and H3.3 histone synthesis by binding to H1˚ and H3.3 histone mRNAs. The encoded protein can bind calmodulin as well, providung a possible link between calcium-dependent signals and histone metabolism. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.