E7 (NC_001531) Virus Tagged ORF Clone

CAT#: VC101957

  • TrueORF®

Myc-DDK-tagged ORF clone of viral ORF for transforming protein [Human papillomavirus type 5], codon optimized for human cell expression, NP_041366


  "NC_001531" in other vectors (6)

Reconstitution Protocol

USD 400.00

In Stock*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Virus Tagged ORF Clone
Tag Myc-DDK
Symbol E7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>The Viral ORF clone VC101957 represents NCBI reference of NP_041366 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTGGTAAGGAAGTGACCGTCCAGGACATTATTCTTGAACTGTCAGAAGTACAGCCAGAGGTGCTTC
CTGTCGACCTGTTCTGCGAGGAGGAGTTGCCTAATGAGCAGGAGACAGAGGAAGAACCTGACAATGAGAG
AATCAGCTATAAAGTGATAGCACCCTGTGGGTGCCGAAACTGTGAAGTGAAGCTCAGAATCTTTGTCCAT
GCGACTGAGTTTGGCATCCGCGCGTTCCAGCAGTTGCTGACCGGAGATCTGCAGTTGCTGTGCCCGGACT
GTCGGGGTAACTGTAAACACGACGGATCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>VC101957 representing NP_041366
Red=Cloning sites Green=Tags

MIGKEVTVQDIILELSEVQPEVLPVDLFCEEELPNEQETEEEPDNERISYKVIAPCGCRNCEVKLRIFVH
ATEFGIRAFQQLLTGDLQLLCPDCRGNCKHDGS

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
ACCN NC_001531
ORF Size 309 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Reference Data
RefSeq NC_001531.1, NP_041366
RefSeq ORF 309
Locus ID 1489048
MW 11.7 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.