coronavirus nsp6 (NC_001451) Virus Tagged ORF Clone
CAT#: VC102257
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp6 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740627
"NC_001451" in other vectors (19)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | coronavirus nsp6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC102257 represents NCBI reference of NP_740627 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAATAATGAGCTTATGCCCCACGGAGTGAAAACCAAGGCCTGTGTTGCTGGAGTCGACCAGGCACACT GCTCAGTGGAGTCTAAGTGCTACTATACCAATATCAGTGGCAACAGTGTCGTGGCCGCGATTACATCCTC TAACCCCAACCTGAAGGTGGCTAGTTTTCTGAACGAAGCCGGAAATCAGATATACGTGGACCTGGACCCC CCCTGTAAGTTCGGCATGAAGGTTGGAGTTAAGGTAGAAGTAGTGTATCTGTACTTTATCAAAAACACGC GCAGCATCGTGCGAGGTATGGTTCTGGGGGCAATATCTAATGTGGTGGTCCTTCAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC102257 representing NP_740627
Red=Cloning sites Green=Tags MNNELMPHGVKTKACVAGVDQAHCSVESKCYYTNISGNSVVAAITSSNPNLKVASFLNEAGNQIYVDLDP PCKFGMKVGVKVEVVYLYFIKNTRSIVRGMVLGAISNVVVLQ TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001451 |
ORF Size | 336 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_001451.1, NP_740627 |
RefSeq ORF | 336 |
MW | 12.1 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC102242 | Myc-DDK-tagged ORF clone of viral ORF for spike protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040831 |
USD 1,840.00 |
|
VC102243 | Myc-DDK-tagged ORF clone of viral ORF for 3a protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040832 |
USD 400.00 |
|
VC102244 | Myc-DDK-tagged ORF clone of viral ORF for 3b protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040833 |
USD 400.00 |
|
VC102245 | Myc-DDK-tagged ORF clone of viral ORF for small virion-associated protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040834 |
USD 400.00 |
|
VC102246 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040835 |
USD 400.00 |
|
VC102247 | Myc-DDK-tagged ORF clone of viral ORF for 5a protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040836 |
USD 400.00 |
|
VC102248 | Myc-DDK-tagged ORF clone of viral ORF for 5b protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040837 |
USD 400.00 |
|
VC102249 | Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid protein [Infectious bronchitis virus], codon optimized for human cell expression, NP_040838 |
USD 520.00 |
|
VC102251 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp8 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740621 |
USD 400.00 |
|
VC102253 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp2 (3CL-Pro) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740623 |
USD 400.00 |
|
VC102254 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp3 (HD2) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740624 |
USD 400.00 |
|
VC102255 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp4 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740625 |
USD 400.00 |
|
VC102256 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp5 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740626 |
USD 400.00 |
|
VC102258 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp7 (GLF) [Infectious bronchitis virus], codon optimized for human cell expression, NP_740628 |
USD 400.00 |
|
VC102260 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp10 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740630 |
USD 760.00 |
|
VC102261 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp11 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740631 |
USD 670.00 |
|
VC102262 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp12 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740632 |
USD 430.00 |
|
VC102263 | Myc-DDK-tagged ORF clone of viral ORF for coronavirus nsp13 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740633 |
USD 400.00 |
|
VC102264 | Myc-DDK-tagged ORF clone of viral ORF for leader protein p87 [Infectious bronchitis virus], codon optimized for human cell expression, NP_740634 |
USD 1,070.00 |
{0} Product Review(s)
Be the first one to submit a review