BTK (NM_000061) Human Mutant ORF Clone
CAT#: RC400776
- TrueORF®
BTK Mutant (S21X), Myc-DDK-tagged ORF clone of Homo sapiens Bruton agammaglobulinemia tyrosine kinase (BTK) as transfection-ready DNA
Product Images
Other products for "BTK"
Specifications
Product Data | |
Mutation Description | S21X |
Affected Codon# | 21 |
Affected NT# | 62 |
Tag | Myc-DDK |
Effect | Ammlobulinemi |
Symbol | BTK |
Synonyms | AGMX1; AT; ATK; BPK; IGHD3; IMD1; PSCTK1; XLA |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Vector | pCMV6-Entry |
ACCN | NM_000061 |
ORF Size | 60 bp |
Sequence Data |
>RC400776 representing NM_000061
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGCAGTGATTCTGGAGAGCATCTTTCTGAAGCGATCCCAACAGAAAAAGAAAACA AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC TGGATTACAAGGATGACGACGA TAAGGTTTAA >RC400776 representing NM_000061
Red=Cloning site Green=Tags(s) MAAVILESIFLKRSQQKKKT SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reference Data | |
RefSeq | NP_000052 |
RefSeq Size | 60 bp |
RefSeq ORF | 1980 bp |
Locus ID | 695 |
Cytogenetics | Xq22.1 |
Domains | pkinase, SH2, TyrKc, SH3, BTK, PH, S_TKc |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Primary immunodeficiency |
MW | 2.2 kDa |
Gene Summary | 'The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2013]' |
Documents
Product Manuals |
FAQs |
Resources
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.