MSH6 (NM_000179) Human Mutant ORF Clone

CAT#: RC401392

  • TrueORF®

MSH6 Mutant (S200X), Myc-DDK-tagged ORF clone of Homo sapiens mutS homolog 6 (E. coli) (MSH6) as transfection-ready DNA

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "MSH6"

Specifications

Product Data
Mutation Description S200X
Affected Codon# 200
Affected NT# 599
Tag Myc-DDK
Effect Colorel ner
Symbol MSH6
Synonyms GTBP; GTMBP; HNPCC5; HSAP; p160
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Vector pCMV6-Entry
ACCN NM_000179
ORF Size 597 bp
Sequence Data
>RC401392 representing NM_000179
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCGACAGAGCACCCTGTACAGCTTCTTCCCCAAGTCTCCGGCGCTGAGTGATGCCAACAAGGCCT
CGGCCAGGGCCTCACGCGAAGGCGGCCGTGCCGCCGCTGCCCCCGGGGCCTCTCCTTCCCCAGGCGGGGA
TGCGGCCTGGAGCGAGGCTGGGCCTGGGCCCAGGCCCTTGGCGCGCTCCGCGTCACCGCCCAAGGCGAAG
AACCTCAACGGAGGGCTGCGGAGATCGGTAGCGCCTGCTGCCCCCACCAGTTGTGACTTCTCACCAGGAG
ATTTGGTTTGGGCCAAGATGGAGGGTTACCCCTGGTGGCCTTGTCTGGTTTACAACCACCCCTTTGATGG
AACATTCATCCGCGAGAAAGGGAAATCAGTCCGTGTTCATGTACAGTTTTTTGATGACAGCCCAACAAGG
GGCTGGGTTAGCAAAAGGCTTTTAAAGCCATATACAGGTTCAAAATCAAAGGAAGCCCAGAAGGGAGGTC
ATTTTTACAGTGCAAAGCCTGAAATACTGAGAGCAATGCAACGTGCAGATGAAGCCTTAAATAAAGACAA
GATTAAGAGGCTTGAATTGGCAGTTTGTGATGAGCCC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC401392 representing NM_000179
Red=Cloning site Green=Tags(s)

MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAK
NLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTR
GWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRADEALNKDKIKRLELAVCDEP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NP_000170
RefSeq Size 597 bp
RefSeq ORF 4083 bp
Locus ID 2956
Cytogenetics 2p16.3
Domains PWWP, MutS_V, MutS_I, MutS_III, MutS_II, MutS_IV
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Colorectal cancer, Mismatch repair, Pathways in cancer
MW 21.9 kDa
Gene Summary This gene encodes a member of the DNA mismatch repair MutS family. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein heterodimerizes with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene may be associated with hereditary nonpolyposis colon cancer, colorectal cancer, and endometrial cancer. Transcripts variants encoding different isoforms have been described. [provided by RefSeq, Jul 2013]

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.