MSH2 (NM_000251) Human Mutant ORF Clone

CAT#: RC401700

MSH2 Mutant (Q10X), Myc-DDK-tagged ORF clone of Homo sapiens mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) (MSH2) as transfection-ready DNA

Specifications

Product Data

• Mutation Description: Q10X
• Affected Codon#: 10
• Affected NT#: 28
• Tag: Myc-DDK
• Effect: Colorel ner, non-polyposis
• Symbol: MSH2
• Synonyms: COCA1; FCC1; hMSH2; HNPCC; HNPCC1; LCFS2
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Vector: pCMV6-Entry
• ACCN: NM_000251
• ORF Size: 27 bp
• Sequence Data:
  ORF Nucleotide Sequence

  >RC401700 representing NM_000251
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGGTGCAGCCGAAGGAGACGCTG
  
  AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
  TGGATTACAAGGATGACGACGA TAAGGTTTAA
  Protein Sequence

  >RC401700 representing NM_000251
  Red=Cloning site Green=Tags(s)
  
  MAVQPKETL
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.

Reference Data

• RefSeq: NP_000242
• RefSeq Size: 27 bp
• RefSeq ORF: 2805 bp
• Locus ID: 4436
• Cytogenetics: 2p21-p16.3
• Domains: MutS_V, MutS_I, MutS_III, MutS_II, MutS_IV
• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Colorectal cancer, Mismatch repair, Pathways in cancer
• MW: 1 kDa
• Gene Summary: 'This locus is frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]'