Menin (MEN1) (NM_130799) Human Mutant ORF Clone

CAT#: RC403544

  • TrueORF®

MEN1 Mutant (Q141X), Myc-DDK-tagged ORF clone of Homo sapiens multiple endocrine neoplasia I (MEN1), transcript variant 2 as transfection-ready DNA

Reconstitution Protocol

USD 420.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "MEN1"

Specifications

Product Data
Mutation Description Q141X
Affected Codon# 141
Affected NT# 421
Tag Myc-DDK
Effect Multiple endocrine neoplasia 1
Symbol MEN1
Synonyms MEAI; SCG2
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Vector pCMV6-Entry
ACCN NM_130799
ORF Size 420 bp
Sequence Data
>RC403544 representing NM_130799
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTGAAGGCCGCCCAGAAGACGCTGTTCCCGCTGCGCTCCATCGACGACGTGGTGCGCCTGTTTG
CTGCCGAGCTGGGCCGAGAGGAGCCGGACCTGGTGCTCCTTTCCTTGGTGCTGGGCTTCGTGGAGCATTT
TCTGGCTGTCAACCGCGTCATCCCTACCAACGTTCCCGAGCTCACCTTCCAGCCCAGCCCCGCCCCCGAC
CCGCCTGGCGGCCTCACCTACTTTCCCGTGGCCGACCTGTCTATCATCGCCGCCCTCTATGCCCGCTTCA
CCGCCCAGATCCGAGGCGCCGTCGACCTGTCCCTCTATCCTCGAGAAGGGGGTGTCTCCAGCCGTGAGCT
GGTGAAGAAGGTCTCCGATGTCATATGGAACAGCCTCAGCCGCTCCTACTTCAAGGATCGGGCCCACATC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGA TAAG
GTTTAA
>RC403544 representing NM_130799
Red=Cloning site Green=Tags(s)

MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPELTFQPSPAPD
PPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHI

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI      Cloning Scheme for this gene     
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NP_570711
RefSeq Size 420 bp
RefSeq ORF 1833 bp
Locus ID 4221
Cytogenetics 11q13.1
Domains Menin
Protein Families Druggable Genome, Transcription Factors
MW 15.4 kDa
Gene Summary 'This gene encodes menin, a tumor suppressor associated with a syndrome known as multiple endocrine neoplasia type 1. Menin is a scaffold protein that functions in histone modification and epigenetic gene regulation. It is thought to regulate several pathways and processes by altering chromatin structure through the modification of histones. [provided by RefSeq, May 2019]'

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.