Junctional Adhesion Molecule 1 (F11R) (NM_144504) Human Mass Spec Standard
CAT#: PH300004
F11R MS Standard C13 and N15-labeled recombinant protein (NP_653087)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200004 |
Predicted MW | 32.6 kDa |
Protein Sequence |
>RC200004 protein sequence
Red=Cloning site Green=Tags(s) MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY SQPSARSEGEFKQTSSFLV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_653087 |
RefSeq Size | 3794 |
RefSeq ORF | 897 |
Synonyms | JAM, KAT, JAM1, JAMA, JCAM, CD321, JAM-1, JAM-A, PAM-1 |
Locus ID | 50848 |
Cytogenetics | 1q23.3 |
Summary | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. The protein encoded by this immunoglobulin superfamily gene member is an important regulator of tight junction assembly in epithelia. In addition, the encoded protein can act as (1) a receptor for reovirus, (2) a ligand for the integrin LFA1, involved in leukocyte transmigration, and (3) a platelet receptor. Multiple 5' alternatively spliced variants, encoding the same protein, have been identified but their biological validity has not been established. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Epithelial cell signaling in Helicobacter pylori infection, Leukocyte transendothelial migration, Tight junction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403392 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC413796 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429529 | F11R HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403392 | Transient overexpression lysate of F11 receptor (F11R), transcript variant 5 |
USD 396.00 |
|
LY413796 | Transient overexpression lysate of F11 receptor (F11R) |
USD 396.00 |
|
LY429529 | Transient overexpression lysate of F11 receptor (F11R) |
USD 396.00 |
|
PH321478 | F11R MS Standard C13 and N15-labeled recombinant protein (NP_058642) |
USD 2,055.00 |
|
TP300004 | Recombinant protein of human F11 receptor (F11R), transcript variant 5 |
USD 439.00 |
|
TP319217 | Recombinant protein of human F11 receptor (F11R), transcript variant 4 |
USD 748.00 |
|
TP321478 | Recombinant protein of human F11 receptor (F11R) |
USD 748.00 |
|
TP720393 | Recombinant protein of human F11 receptor (F11R) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review