SNRNP25 (NM_024571) Human Mass Spec Standard

CAT#: PH300010

SNRNP25 MS Standard C13 and N15-labeled recombinant protein (NP_078847)

Product Images

Coomassie blue staining of purified SNRNP25 protein (Cat# TP300010). The protein was produced from HEK293T cells transfected with SNRNP25 cDNA clone (Cat# RC200010) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200010
• Predicted MW: 15.3 kDa
• Protein Sequence:
  Sequence Link

  >RC200010 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAI
  QRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_078847
• RefSeq Size: 1103
• RefSeq ORF: 396
• Synonyms: C16orf33
• Locus ID: 79622
• UniProt ID: Q9BV90, Q4TT61
• Cytogenetics: 16p13.3
• Summary: Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome. [provided by RefSeq, Apr 2010]
• Protein Families: Druggable Genome