SNRNP25 (NM_024571) Human Mass Spec Standard
CAT#: PH300010
SNRNP25 MS Standard C13 and N15-labeled recombinant protein (NP_078847)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200010 |
Predicted MW | 15.3 kDa |
Protein Sequence |
>RC200010 protein sequence
Red=Cloning site Green=Tags(s) MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKAI QRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_078847 |
RefSeq Size | 1103 |
RefSeq ORF | 396 |
Synonyms | C16orf33 |
Locus ID | 79622 |
UniProt ID | Q9BV90, Q4TT61 |
Cytogenetics | 16p13.3 |
Summary | Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome. [provided by RefSeq, Apr 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411237 | SNRNP25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY411237 | Transient overexpression lysate of small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25) |
USD 396.00 |
|
TP300010 | Recombinant protein of human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review